Lineage for d1fmxa_ (1fmx A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1796116Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 1796117Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. 1797457Family b.50.1.2: Pepsin-like [50646] (11 proteins)
    duplication: consists of two similar barrel domains
    N-terminal: barrel, partly opened; n*=6, S*=10
  6. 1797458Protein Acid protease [50649] (9 species)
  7. 1797459Species Baker's yeast (Saccharomyces cerevisiae), proteinase A [TaxId:4932] [50654] (11 PDB entries)
    synonym: saccharopepsin
  8. 1797467Domain d1fmxa_: 1fmx A: [70141]
    complexed with nag

Details for d1fmxa_

PDB Entry: 1fmx (more details), 2.61 Å

PDB Description: structure of native proteinase a in the space group p21
PDB Compounds: (A:) saccharopepsin

SCOPe Domain Sequences for d1fmxa_:

Sequence, based on SEQRES records: (download)

>d1fmxa_ b.50.1.2 (A:) Acid protease {Baker's yeast (Saccharomyces cerevisiae), proteinase A [TaxId: 4932]}
gghdvpltnylnaqyytditlgtppqnfkvildtgssnlwvpsnecgslacflhskydhe
asssykangtefaiqygtgslegyisqdtlsigdltipkqdfaeatsepgltfafgkfdg
ilglgydtisvdkvvppfynaiqqdlldekrfafylgdtskdtenggeatfggideskfk
gditwlpvrrkaywevkfegiglgdeyaeleshgaaidtgtslitlpsglaeminaeiga
kkgwtgqytldcntrdnlpdlifnfngynftigpydytlevsgscisaitpmdfpepvgp
laivgdaflrkyysiydlgnnavglakai

Sequence, based on observed residues (ATOM records): (download)

>d1fmxa_ b.50.1.2 (A:) Acid protease {Baker's yeast (Saccharomyces cerevisiae), proteinase A [TaxId: 4932]}
gghdvpltnylnaqyytditlgtppqnfkvildtgssnlwvpsnecgslacflhskydhe
asssykangtefaiqylegyisqdtlsigdltipkqdfaeatsepgltfafgkfdgilgl
gydtisvdkvvppfynaiqqdlldekrfafylgdtskdtenggeatfggideskfkgdit
wlpvrrkaywevkfegiglgdeyaeleshgaaidtgtslitlpsglaeminaeigakkgw
tgqytldcntrdnlpdlifnfngynftigpydytlevsgscisaitpmdfpepvgplaiv
gdaflrkyysiydlgnnavglakai

SCOPe Domain Coordinates for d1fmxa_:

Click to download the PDB-style file with coordinates for d1fmxa_.
(The format of our PDB-style files is described here.)

Timeline for d1fmxa_: