SCOP 1.67: Domain d1fl9a_: 1fl9 A:

Lineage for d1fl9a_ (1fl9 A:)

1. Root: SCOP 1.67

2. Class c: Alpha and beta proteins (a/b) [51349] (130 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (22 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.18: YjeE-like [75213] (1 protein)
   mixed beta-sheet; order 234156(0), strands 2 and 6 are antiparallel to the rest

6. Protein Hypothetical protein HI0065 [75214] (1 species)

7. Species Haemophilus influenzae [TaxId:727] [75215] (2 PDB entries)

8. Domain d1fl9a_: 1fl9 A: [70137]

Details for d1fl9a_

PDB Entry: 1fl9, 2.5 Å

PDB Description: the yjee protein

SCOP Domain Sequences for d1fl9a_:

Sequence; same for both SEQRES and ATOM records:

>d1fl9a_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae}
mesltqyipdefsmlrfgkkfaeillklhtekaimvylngdlgagkttltrgmlqgighq
gnvksptytlveeyniagkmiyhfdlyrladpeelefmgirdyfntdsicliewsekgqg
ilpeadilvnidyyddarnieliaqtnlgkniisafs

Timeline for d1fl9a_:

• d1fl9a_ first appeared in SCOP 1.61
  
• d1fl9a_ appears in SCOP 1.65
  
• d1fl9a_ appears in SCOP 1.69
  
• d1fl9a_ appears in the current release, SCOPe 2.08