Class c: Alpha and beta proteins (a/b) [51349] (130 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (22 families) division into families based on beta-sheet topologies |
Family c.37.1.18: YjeE-like [75213] (1 protein) mixed beta-sheet; order 234156(0), strands 2 and 6 are antiparallel to the rest |
Protein Hypothetical protein HI0065 [75214] (1 species) |
Species Haemophilus influenzae [TaxId:727] [75215] (2 PDB entries) |
Domain d1fl9a_: 1fl9 A: [70137] |
PDB Entry: 1fl9 (more details), 2.5 Å
SCOP Domain Sequences for d1fl9a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fl9a_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae} mesltqyipdefsmlrfgkkfaeillklhtekaimvylngdlgagkttltrgmlqgighq gnvksptytlveeyniagkmiyhfdlyrladpeelefmgirdyfntdsicliewsekgqg ilpeadilvnidyyddarnieliaqtnlgkniisafs
Timeline for d1fl9a_: