SCOPe 2.05: Domain d1esza_: 1esz A:

Lineage for d1esza_ (1esz A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.92: Chelatase-like [53799] (3 superfamilies)
   duplication: tandem repeat of two domains; 3 layers (a/b/a); parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.92.2: "Helical backbone" metal receptor [53807] (5 families)
   contains a long alpha helical insertion in the interdomain linker

5. Family c.92.2.1: Periplasmic ferric siderophore binding protein FhuD [53808] (1 protein)
   automatically mapped to Pfam PF01497

6. Protein Periplasmic ferric siderophore binding protein FhuD [53809] (1 species)

7. Species Escherichia coli [TaxId:562] [53810] (4 PDB entries)

8. Domain d1esza_: 1esz A: [70132]
   complexed with coprogen
   complexed with cpo

Details for d1esza_

PDB Entry: 1esz, 2 Å

PDB Description: structure of the periplasmic ferric siderophore binding protein fhud complexed with coprogen

PDB Compounds: (A:) ferrichrome-binding periplasmic protein

SCOPe Domain Sequences for d1esza_:

Sequence; same for both SEQRES and ATOM records:

>d1esza_ c.92.2.1 (A:) Periplasmic ferric siderophore binding protein FhuD {Escherichia coli [TaxId: 562]}
idpnrivalewlpvelllalgivpygvadtinyrlwvsepplpdsvidvglrtepnlell
temkpsfmvwsagygpspemlariapgrgfnfsdgkqplamarksltemadllnlqsaae
thlaqyedfirsmkprfvkrgarplllttlidprhmlvfgpnslfqeildeygipnawqg
etnfwgstavsidrlaaykdvdvlcfdhdnskdmdalmatplwqampfvragrfqrvpav
wfygatlsamhfvrvldnai

Timeline for d1esza_:

• d1esza_ first appeared in SCOP 1.61
  
• d1esza_ appears in SCOPe 2.04
  
• d1esza_ appears in SCOPe 2.06
  
• d1esza_ appears in the current release, SCOPe 2.08