Lineage for d1esza_ (1esz A:)
- Root: SCOP 1.61
Class c: Alpha and beta proteins (a/b) [51349] (117 folds) 
Fold c.92: Chelatase-like [53799] (2 superfamilies) Superfamily c.92.2: "Helical backbone" metal receptor [53807] (3 families) 
Family c.92.2.1: Periplasmic ferric siderophore binding protein FhuD [53808] (1 protein) Protein Periplasmic ferric siderophore binding protein FhuD [53809] (1 species) Species Escherichia coli [TaxId:562] [53810] (4 PDB entries) 
Domain d1esza_: 1esz A: [70132]
Details for d1esza_
PDB Entry: 1esz (more details), 2 Å
PDB Description: structure of the periplasmic ferric siderophore binding protein fhud complexed with coprogen
SCOP Domain Sequences for d1esza_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1esza_ c.92.2.1 (A:) Periplasmic ferric siderophore binding protein FhuD {Escherichia coli}
idpnrivalewlpvelllalgivpygvadtinyrlwvsepplpdsvidvglrtepnlell
temkpsfmvwsagygpspemlariapgrgfnfsdgkqplamarksltemadllnlqsaae
thlaqyedfirsmkprfvkrgarplllttlidprhmlvfgpnslfqeildeygipnawqg
etnfwgstavsidrlaaykdvdvlcfdhdnskdmdalmatplwqampfvragrfqrvpav
wfygatlsamhfvrvldnai
SCOP Domain Coordinates for d1esza_:
Click to download the PDB-style file with coordinates for d1esza_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1esza_:
- d1esza_ is new in SCOP 1.61
- d1esza_ appears in SCOP 1.63
- d1esza_ appears in the current release, SCOPe 2.08
View in 3D