Lineage for d1em7a_ (1em7 A:)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 189214Fold d.15: beta-Grasp (ubiquitin-like) [54235] (9 superfamilies)
  4. 189692Superfamily d.15.7: Immunoglobulin-binding domains [54358] (1 family) (S)
  5. 189693Family d.15.7.1: Immunoglobulin-binding domains [54359] (2 proteins)
  6. 189715Protein Immunoglobulin-binding protein G, different constituent domains [54360] (1 species)
  7. 189716Species Streptococcus sp., group G [TaxId:1306] [54361] (17 PDB entries)
  8. 189723Domain d1em7a_: 1em7 A: [70131]

Details for d1em7a_

PDB Entry: 1em7 (more details), 2 Å

PDB Description: helix variant of the b1 domain from streptococcal protein g

SCOP Domain Sequences for d1em7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1em7a_ d.15.7.1 (A:) Immunoglobulin-binding protein G, different constituent domains {Streptococcus sp., group G}
ttyklilngktlkgettteavdaetaervfkeyakkngvdgewtyddatktftvte

SCOP Domain Coordinates for d1em7a_:

Click to download the PDB-style file with coordinates for d1em7a_.
(The format of our PDB-style files is described here.)

Timeline for d1em7a_: