SCOPe 2.05: Domain d1elmp_: 1elm P:

Lineage for d1elmp_ (1elm P:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
   core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops

4. Superfamily c.56.5: Zn-dependent exopeptidases [53187] (10 families)
   core: mixed beta-sheet of 8 strands, order 12435867; strands 2, 6 & 7 are antiparallel to the rest

5. Family c.56.5.1: Pancreatic carboxypeptidases [53188] (5 proteins)

6. Protein Carboxypeptidase A [53189] (4 species)

7. Species Cow (Bos taurus) [TaxId:9913] [53190] (34 PDB entries)

8. Domain d1elmp_: 1elm P: [70130]
   complexed with cd

Details for d1elmp_

PDB Entry: 1elm, 2 Å

PDB Description: cadmium-substituted bovine pacreatic carboxypeptidase a (alfa-form) at ph 5.5 and 2 mm chloride in monoclinic crystal form.

PDB Compounds: (P:) carboxypeptidase a

SCOPe Domain Sequences for d1elmp_:

Sequence; same for both SEQRES and ATOM records:

>d1elmp_ c.56.5.1 (P:) Carboxypeptidase A {Cow (Bos taurus) [TaxId: 9913]}
arstntfnyatyhtldeiydfmdllvaehpqlvsklqigrsyegrpiyvlkfstggsnrp
aiwidlgihsrewitqatgvwfakkftedygqdpsftaildsmdifleivtnpdgfafth
sqnrlwrktrsvtssslcvgvdanrnwdagfgkagassspcsetyhgkyansevevksiv
dfvkdhgnfkaflsihsysqlllypygyttqsipdktelnqvaksavaalkslygtsyky
gsiittiyqasggsidwsynqgikysftfelrdtgrygfllpasqiiptaqetwlgvlti
mehtv

Timeline for d1elmp_:

• d1elmp_ first appeared in SCOP 1.61
  
• d1elmp_ appears in SCOPe 2.04
  
• d1elmp_ appears in SCOPe 2.06
  
• d1elmp_ appears in the current release, SCOPe 2.08