SCOP 1.71: Domain d1eakd2: 1eak D:108-216,D:394-450

Lineage for d1eakd2 (1eak D:108-216,D:394-450)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)
   contains mixed beta sheet with connection over free side of the sheet

4. Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (15 families)

5. Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (13 proteins)

6. Protein Gelatinase A [55534] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [55535] (4 PDB entries)

8. Domain d1eakd2: 1eak D:108-216,D:394-450 [70109]
   Other proteins in same PDB: d1eaka1, d1eaka3, d1eaka4, d1eaka5, d1eakb1, d1eakb3, d1eakb4, d1eakb5, d1eakc1, d1eakc3, d1eakc4, d1eakc5, d1eakd1, d1eakd3, d1eakd4, d1eakd5
   complexed with ca, so4, zn; mutant

Details for d1eakd2

PDB Entry: 1eak, 2.66 Å

PDB Description: catalytic domain of prommp-2 e404q mutant

SCOP Domain Sequences for d1eakd2:

Sequence; same for both SEQRES and ATOM records:

>d1eakd2 d.92.1.11 (D:108-216,D:394-450) Gelatinase A {Human (Homo sapiens)}
anynffprkpkwdknqityriigytpdldpetvddafarafqvwsdvtplrfsrihdgea
diminfgrwehgdgypfdgkdgllahafapgtgvggdshfdddelwtlgXgyslflvaah
qfghamglehsqdpgalmapiytytknfrlsqddikgiqelygaspd

Timeline for d1eakd2:

• d1eakd2 first appeared in SCOP 1.61
  
• d1eakd2 appears in SCOP 1.69
  
• d1eakd2 appears in SCOP 1.73
  
• d1eakd2 appears in the current release, SCOPe 2.08