Lineage for d1eakb5 (1eak B:336-393)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2638013Fold g.14: Kringle-like [57439] (1 superfamily)
    disulfide-rich fold; nearly all-beta
  4. 2638014Superfamily g.14.1: Kringle-like [57440] (3 families) (S)
  5. 2638179Family g.14.1.2: Fibronectin type II module [57459] (4 proteins)
    shorter two-disulfide version of a kringle module
  6. 2638188Protein Gelatinase A (MMP-2) type II modules [57464] (1 species)
    duplication: tandem repeat of three modules inserted in the catalytic domain
  7. 2638189Species Human (Homo sapiens) [TaxId:9606] [57465] (6 PDB entries)
  8. 2638195Domain d1eakb5: 1eak B:336-393 [70102]
    Other proteins in same PDB: d1eaka1, d1eaka2, d1eakb1, d1eakb2, d1eakc1, d1eakc2, d1eakd1, d1eakd2
    complexed with ca, so4, zn; mutant

Details for d1eakb5

PDB Entry: 1eak (more details), 2.66 Å

PDB Description: catalytic domain of prommp-2 e404q mutant
PDB Compounds: (B:) 72 kda type IV collagenase

SCOPe Domain Sequences for d1eakb5:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eakb5 g.14.1.2 (B:336-393) Gelatinase A (MMP-2) type II modules {Human (Homo sapiens) [TaxId: 9606]}
amstvggnsegapcvfpftflgnkyesctsagrsdgkmwcattanydddrkwgfcpdq

SCOPe Domain Coordinates for d1eakb5:

Click to download the PDB-style file with coordinates for d1eakb5.
(The format of our PDB-style files is described here.)

Timeline for d1eakb5: