SCOP 1.73: Domain d1ea9d3: 1ea9 D:122-503

Lineage for d1ea9d3 (1ea9 D:122-503)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (14 families)

5. Family c.1.8.1: Amylase, catalytic domain [51446] (24 proteins)
   members of the family may contain various insert subdomains
   in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain

6. Protein Maltogenic amylase, central domain [51465] (4 species)
   contains an additional N-terminal domain

7. Species Bacillus sp., cyclomaltodextrinase [TaxId:1409] [75060] (1 PDB entry)

8. Domain d1ea9d3: 1ea9 D:122-503 [70092]
   Other proteins in same PDB: d1ea9c1, d1ea9c2, d1ea9d1, d1ea9d2

Details for d1ea9d3

PDB Entry: 1ea9, 3.2 Å

PDB Description: cyclomaltodextrinase

PDB Compounds: (D:) cyclomaltodextrinase

SCOP Domain Sequences for d1ea9d3:

Sequence; same for both SEQRES and ATOM records:

>d1ea9d3 c.1.8.1 (D:122-503) Maltogenic amylase, central domain {Bacillus sp., cyclomaltodextrinase [TaxId: 1409]}
fqppawvkdaifyqifperfangdtrndpegtlpwgsadptpscffggdlqgvidhldhl
sklgvnavyftplfkattnhkydtedyfqidpqfgdkdtlkklvdlchergirvlldavf
nhsgrtfppfvdvlkngekskykdwfhirslplevvdgiptydtfafeplmpklntehpd
vkeyllkaaeywiretgidgwrldvanevshqfwrefrrvvkqanpdayilgevwhessi
wlegdqfdavmnypftnavldffihqiadaekfsfmlgkqlagyprqasevmfnlldshd
tarlltqadgdkrkmklavlfqftyfgtpciyygdevgldgghdpgcrkcmewdetkhdk
dlfafyqtvirlrqahaalrtg

Timeline for d1ea9d3:

• d1ea9d3 first appeared in SCOP 1.61
  
• d1ea9d3 appears in SCOP 1.71
  
• d1ea9d3 appears in SCOP 1.75
  
• d1ea9d3 appears in the current release, SCOPe 2.08