Class b: All beta proteins [48724] (178 folds) |
Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily) folded sheet; greek-key |
Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) this domain is C-terminal to the catalytic beta/alpha barrel domain |
Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins) this domain follows the catalytic beta/alpha barrel domain |
Protein Maltogenic amylase [51031] (4 species) |
Species Bacillus sp., cyclomaltodextrinase [TaxId:1409] [75016] (1 PDB entry) |
Domain d1ea9d2: 1ea9 D:504-583 [70091] Other proteins in same PDB: d1ea9c1, d1ea9c3, d1ea9d1, d1ea9d3 |
PDB Entry: 1ea9 (more details), 3.2 Å
SCOPe Domain Sequences for d1ea9d2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ea9d2 b.71.1.1 (D:504-583) Maltogenic amylase {Bacillus sp., cyclomaltodextrinase [TaxId: 1409]} tfkfltaeknsrqiaylreddqdtilvvmnndkaghtltlpvrhaqwthlwqddvltaah gqltvklpaygfavlkassd
Timeline for d1ea9d2: