SCOP 1.73: Domain d1ea9d2: 1ea9 D:504-583

Lineage for d1ea9d2 (1ea9 D:504-583)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
   folded sheet; greek-key

4. Superfamily b.71.1: Glycosyl hydrolase domain [51011] (5 families)
   this domain is C-terminal to the catalytic beta/alpha barrel domain

5. Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (21 proteins)
   this domain follows the catalytic beta/alpha barrel domain

6. Protein Maltogenic amylase [51031] (4 species)

7. Species Bacillus sp., cyclomaltodextrinase [TaxId:1409] [75016] (1 PDB entry)

8. Domain d1ea9d2: 1ea9 D:504-583 [70091]
   Other proteins in same PDB: d1ea9c1, d1ea9c3, d1ea9d1, d1ea9d3

Details for d1ea9d2

PDB Entry: 1ea9, 3.2 Å

PDB Description: cyclomaltodextrinase

PDB Compounds: (D:) cyclomaltodextrinase

SCOP Domain Sequences for d1ea9d2:

Sequence; same for both SEQRES and ATOM records:

>d1ea9d2 b.71.1.1 (D:504-583) Maltogenic amylase {Bacillus sp., cyclomaltodextrinase [TaxId: 1409]}
tfkfltaeknsrqiaylreddqdtilvvmnndkaghtltlpvrhaqwthlwqddvltaah
gqltvklpaygfavlkassd

Timeline for d1ea9d2:

• d1ea9d2 first appeared in SCOP 1.61
  
• d1ea9d2 appears in SCOP 1.71
  
• d1ea9d2 appears in SCOP 1.75
  
• d1ea9d2 appears in the current release, SCOPe 2.08