Lineage for d1ea9d2 (1ea9 D:504-583)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 675781Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 675782Superfamily b.71.1: Glycosyl hydrolase domain [51011] (5 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 675783Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (21 proteins)
    this domain follows the catalytic beta/alpha barrel domain
  6. 676035Protein Maltogenic amylase [51031] (4 species)
  7. 676036Species Bacillus sp., cyclomaltodextrinase [TaxId:1409] [75016] (1 PDB entry)
  8. 676038Domain d1ea9d2: 1ea9 D:504-583 [70091]
    Other proteins in same PDB: d1ea9c1, d1ea9c3, d1ea9d1, d1ea9d3

Details for d1ea9d2

PDB Entry: 1ea9 (more details), 3.2 Å

PDB Description: cyclomaltodextrinase
PDB Compounds: (D:) cyclomaltodextrinase

SCOP Domain Sequences for d1ea9d2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ea9d2 b.71.1.1 (D:504-583) Maltogenic amylase {Bacillus sp., cyclomaltodextrinase [TaxId: 1409]}
tfkfltaeknsrqiaylreddqdtilvvmnndkaghtltlpvrhaqwthlwqddvltaah
gqltvklpaygfavlkassd

SCOP Domain Coordinates for d1ea9d2:

Click to download the PDB-style file with coordinates for d1ea9d2.
(The format of our PDB-style files is described here.)

Timeline for d1ea9d2: