Lineage for d1ea9c3 (1ea9 C:122-503)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 172678Fold c.1: TIM beta/alpha-barrel [51350] (25 superfamilies)
  4. 173209Superfamily c.1.8: (Trans)glycosidases [51445] (9 families) (S)
  5. 173210Family c.1.8.1: alpha-Amylases, N-terminal domain [51446] (15 proteins)
  6. 173367Protein Maltogenic amylase, central domain [51465] (4 species)
  7. 173368Species Bacillus sp., cyclomaltodextrinase [TaxId:1409] [75060] (1 PDB entry)
  8. 173369Domain d1ea9c3: 1ea9 C:122-503 [70089]
    Other proteins in same PDB: d1ea9c1, d1ea9c2, d1ea9d1, d1ea9d2

Details for d1ea9c3

PDB Entry: 1ea9 (more details), 3.2 Å

PDB Description: cyclomaltodextrinase

SCOP Domain Sequences for d1ea9c3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ea9c3 c.1.8.1 (C:122-503) Maltogenic amylase, central domain {Bacillus sp., cyclomaltodextrinase}
fqppawvkdaifyqifperfangdtrndpegtlpwgsadptpscffggdlqgvidhldhl
sklgvnavyftplfkattnhkydtedyfqidpqfgdkdtlkklvdlchergirvlldavf
nhsgrtfppfvdvlkngekskykdwfhirslplevvdgiptydtfafeplmpklntehpd
vkeyllkaaeywiretgidgwrldvanevshqfwrefrrvvkqanpdayilgevwhessi
wlegdqfdavmnypftnavldffihqiadaekfsfmlgkqlagyprqasevmfnlldshd
tarlltqadgdkrkmklavlfqftyfgtpciyygdevgldgghdpgcrkcmewdetkhdk
dlfafyqtvirlrqahaalrtg

SCOP Domain Coordinates for d1ea9c3:

Click to download the PDB-style file with coordinates for d1ea9c3.
(The format of our PDB-style files is described here.)

Timeline for d1ea9c3: