Lineage for d1ea9c2 (1ea9 C:504-583)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 170927Fold b.71: alpha-Amylases, C-terminal beta-sheet domain [51010] (1 superfamily)
  4. 170928Superfamily b.71.1: alpha-Amylases, C-terminal beta-sheet domain [51011] (1 family) (S)
  5. 170929Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (14 proteins)
  6. 171081Protein Maltogenic amylase [51031] (4 species)
  7. 171082Species Bacillus sp., cyclomaltodextrinase [TaxId:1409] [75016] (1 PDB entry)
  8. 171083Domain d1ea9c2: 1ea9 C:504-583 [70088]
    Other proteins in same PDB: d1ea9c1, d1ea9c3, d1ea9d1, d1ea9d3

Details for d1ea9c2

PDB Entry: 1ea9 (more details), 3.2 Å

PDB Description: cyclomaltodextrinase

SCOP Domain Sequences for d1ea9c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ea9c2 b.71.1.1 (C:504-583) Maltogenic amylase {Bacillus sp., cyclomaltodextrinase}
tfkfltaeknsrqiaylreddqdtilvvmnndkaghtltlpvrhaqwthlwqddvltaah
gqltvklpaygfavlkassd

SCOP Domain Coordinates for d1ea9c2:

Click to download the PDB-style file with coordinates for d1ea9c2.
(The format of our PDB-style files is described here.)

Timeline for d1ea9c2: