Lineage for d1ea9c1 (1ea9 C:1-121)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 223262Superfamily b.1.18: E set domains [81296] (17 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 223308Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (13 proteins)
    domains of unknown function associated with different type of catalytic domains in a different sequential location
  6. 223402Protein Maltogenic amylase, N-terminal domain N [49221] (4 species)
    precedes the catalytic (beta/alpha)8-barrel domain
  7. 223403Species Bacillus sp., cyclomaltodextrinase [TaxId:1409] [74842] (1 PDB entry)
  8. 223404Domain d1ea9c1: 1ea9 C:1-121 [70087]
    Other proteins in same PDB: d1ea9c2, d1ea9c3, d1ea9d2, d1ea9d3

Details for d1ea9c1

PDB Entry: 1ea9 (more details), 3.2 Å

PDB Description: cyclomaltodextrinase

SCOP Domain Sequences for d1ea9c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ea9c1 b.1.18.2 (C:1-121) Maltogenic amylase, N-terminal domain N {Bacillus sp., cyclomaltodextrinase}
mfleavyhrprknfsyayngttvhlrirtkkddmtavyalagdkymwdhtmeyvpmtkla
tdelfdywecevtppyrrvkygfllqqghekrwmteydflteppanpdrlfeypfinpvd
v

SCOP Domain Coordinates for d1ea9c1:

Click to download the PDB-style file with coordinates for d1ea9c1.
(The format of our PDB-style files is described here.)

Timeline for d1ea9c1: