Lineage for d1cq9d_ (1cq9 D:)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 663169Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 663170Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (25 families) (S)
  5. 663171Family b.29.1.1: Legume lectins [49900] (4 proteins)
  6. 663301Protein Legume lectin [49904] (23 species)
  7. 663507Species Peanut (Arachis hypogaea) [TaxId:3818] [49912] (23 PDB entries)
  8. 663595Domain d1cq9d_: 1cq9 D: [70072]
    complexed with ca, mn

Details for d1cq9d_

PDB Entry: 1cq9 (more details), 3.5 Å

PDB Description: peanut lectin-triclinic form
PDB Compounds: (D:) protein (peanut lectin)

SCOP Domain Sequences for d1cq9d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cq9d_ b.29.1.1 (D:) Legume lectin {Peanut (Arachis hypogaea) [TaxId: 3818]}
aetvsfnfnsfsegnpainfqgdvtvlsngniqltnlnkvnsvgrvlyampvriwssatg
nvasfltsfsfemkdikdydpadgiiffiapedtqipagsigggtlgvsdtkgaghfvgv
efdtysnseyndpptdhvgidvnsvdsvktvpwnsvsgavvkvtviydsstktlsvavtn
dngdittiaqvvdlkaklpervkfgfsasgslggrqihlirswsftstlitt

SCOP Domain Coordinates for d1cq9d_:

Click to download the PDB-style file with coordinates for d1cq9d_.
(The format of our PDB-style files is described here.)

Timeline for d1cq9d_: