SCOPe 2.01: Domain d1cq9c_: 1cq9 C:

Lineage for d1cq9c_ (1cq9 C:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families)

5. Family b.29.1.1: Legume lectins [49900] (5 proteins)

6. Protein Legume lectin [49904] (23 species)

7. Species Peanut (Arachis hypogaea) [TaxId:3818] [49912] (23 PDB entries)
   Uniprot P02872 24-255

8. Domain d1cq9c_: 1cq9 C: [70071]
   complexed with ca, mn

Details for d1cq9c_

PDB Entry: 1cq9, 3.5 Å

PDB Description: peanut lectin-triclinic form

PDB Compounds: (C:) protein (peanut lectin)

SCOPe Domain Sequences for d1cq9c_:

Sequence; same for both SEQRES and ATOM records:

>d1cq9c_ b.29.1.1 (C:) Legume lectin {Peanut (Arachis hypogaea) [TaxId: 3818]}
aetvsfnfnsfsegnpainfqgdvtvlsngniqltnlnkvnsvgrvlyampvriwssatg
nvasfltsfsfemkdikdydpadgiiffiapedtqipagsigggtlgvsdtkgaghfvgv
efdtysnseyndpptdhvgidvnsvdsvktvpwnsvsgavvkvtviydsstktlsvavtn
dngdittiaqvvdlkaklpervkfgfsasgslggrqihlirswsftstlitt

Timeline for d1cq9c_:

• d1cq9c_ first appeared in SCOP 1.61
  
• d1cq9c_ appears in SCOP 1.75
  
• d1cq9c_ appears in SCOPe 2.02
  
• d1cq9c_ appears in the current release, SCOPe 2.08