Lineage for d1cq9c_ (1cq9 C:)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 164500Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
  4. 164501Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (14 families) (S)
  5. 164502Family b.29.1.1: Legume lectins [49900] (4 proteins)
  6. 164615Protein Legume lectin [49904] (20 species)
  7. 164741Species Peanut (Arachis hypogaea) [TaxId:3818] [49912] (7 PDB entries)
  8. 164772Domain d1cq9c_: 1cq9 C: [70071]

Details for d1cq9c_

PDB Entry: 1cq9 (more details), 3.5 Å

PDB Description: peanut lectin-triclinic form

SCOP Domain Sequences for d1cq9c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cq9c_ b.29.1.1 (C:) Legume lectin {Peanut (Arachis hypogaea)}
aetvsfnfnsfsegnpainfqgdvtvlsngniqltnlnkvnsvgrvlyampvriwssatg
nvasfltsfsfemkdikdydpadgiiffiapedtqipagsigggtlgvsdtkgaghfvgv
efdtysnseyndpptdhvgidvnsvdsvktvpwnsvsgavvkvtviydsstktlsvavtn
dngdittiaqvvdlkaklpervkfgfsasgslggrqihlirswsftstlitt

SCOP Domain Coordinates for d1cq9c_:

Click to download the PDB-style file with coordinates for d1cq9c_.
(The format of our PDB-style files is described here.)

Timeline for d1cq9c_: