Lineage for d1cq9b_ (1cq9 B:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2042196Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2042197Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2042198Family b.29.1.1: Legume lectins [49900] (5 protein domains)
  6. 2042364Protein Legume lectin [49904] (23 species)
  7. 2042540Species Peanut (Arachis hypogaea) [TaxId:3818] [49912] (24 PDB entries)
    Uniprot P02872 24-255
  8. 2042644Domain d1cq9b_: 1cq9 B: [70070]
    complexed with ca, mn

Details for d1cq9b_

PDB Entry: 1cq9 (more details), 3.5 Å

PDB Description: peanut lectin-triclinic form
PDB Compounds: (B:) protein (peanut lectin)

SCOPe Domain Sequences for d1cq9b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cq9b_ b.29.1.1 (B:) Legume lectin {Peanut (Arachis hypogaea) [TaxId: 3818]}
aetvsfnfnsfsegnpainfqgdvtvlsngniqltnlnkvnsvgrvlyampvriwssatg
nvasfltsfsfemkdikdydpadgiiffiapedtqipagsigggtlgvsdtkgaghfvgv
efdtysnseyndpptdhvgidvnsvdsvktvpwnsvsgavvkvtviydsstktlsvavtn
dngdittiaqvvdlkaklpervkfgfsasgslggrqihlirswsftstlitt

SCOPe Domain Coordinates for d1cq9b_:

Click to download the PDB-style file with coordinates for d1cq9b_.
(The format of our PDB-style files is described here.)

Timeline for d1cq9b_: