Lineage for d1ck1a1 (1ck1 A:1-121)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2058098Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2058419Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) (S)
  5. 2059068Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (16 proteins)
  6. 2059133Protein Staphylococcal enterotoxin C3, SEC3 [50228] (1 species)
  7. 2059134Species Staphylococcus aureus [TaxId:1280] [50229] (20 PDB entries)
    Uniprot P23313
  8. 2059148Domain d1ck1a1: 1ck1 A:1-121 [70067]
    Other proteins in same PDB: d1ck1a2
    complexed with zn

Details for d1ck1a1

PDB Entry: 1ck1 (more details), 2.6 Å

PDB Description: structure of staphylococcal enterotoxin c3
PDB Compounds: (A:) protein (enterotoxin type c-3)

SCOPe Domain Sequences for d1ck1a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ck1a1 b.40.2.2 (A:1-121) Staphylococcal enterotoxin C3, SEC3 {Staphylococcus aureus [TaxId: 1280]}
esqpdpmpddlhksseftgtmgnmkylyddhyvsatkvksvdkflahdliynindkklnn
ydkvktellnedlankykdevvdvygsnyyvncyfsskdnvgkvtsgktcmyggitkheg
n

SCOPe Domain Coordinates for d1ck1a1:

Click to download the PDB-style file with coordinates for d1ck1a1.
(The format of our PDB-style files is described here.)

Timeline for d1ck1a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ck1a2