SCOP 1.71: Domain d1ck1a1: 1ck1 A:1-121

Lineage for d1ck1a1 (1ck1 A:1-121)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.40: OB-fold [50198] (10 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families)

5. Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (14 proteins)

6. Protein Staphylococcal enterotoxin C3, SEC3 [50228] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [50229] (10 PDB entries)

8. Domain d1ck1a1: 1ck1 A:1-121 [70067]
   Other proteins in same PDB: d1ck1a2
   complexed with zn

Details for d1ck1a1

PDB Entry: 1ck1, 2.6 Å

PDB Description: structure of staphylococcal enterotoxin c3

SCOP Domain Sequences for d1ck1a1:

Sequence; same for both SEQRES and ATOM records:

>d1ck1a1 b.40.2.2 (A:1-121) Staphylococcal enterotoxin C3, SEC3 {Staphylococcus aureus}
esqpdpmpddlhksseftgtmgnmkylyddhyvsatkvksvdkflahdliynindkklnn
ydkvktellnedlankykdevvdvygsnyyvncyfsskdnvgkvtsgktcmyggitkheg
n

Timeline for d1ck1a1:

• d1ck1a1 first appeared in SCOP 1.61
  
• d1ck1a1 appears in SCOP 1.69
  
• d1ck1a1 appears in SCOP 1.73
  
• d1ck1a1 appears in the current release, SCOPe 2.08