Lineage for d1ck1a1 (1ck1 A:1-121)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 166216Fold b.40: OB-fold [50198] (8 superfamilies)
  4. 166278Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families) (S)
  5. 166605Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (12 proteins)
  6. 166644Protein Staphylococcal enterotoxin C3, SEC3 [50228] (1 species)
  7. 166645Species Staphylococcus aureus [TaxId:1280] [50229] (2 PDB entries)
  8. 166646Domain d1ck1a1: 1ck1 A:1-121 [70067]
    Other proteins in same PDB: d1ck1a2

Details for d1ck1a1

PDB Entry: 1ck1 (more details), 2.6 Å

PDB Description: structure of staphylococcal enterotoxin c3

SCOP Domain Sequences for d1ck1a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ck1a1 b.40.2.2 (A:1-121) Staphylococcal enterotoxin C3, SEC3 {Staphylococcus aureus}
esqpdpmpddlhksseftgtmgnmkylyddhyvsatkvksvdkflahdliynindkklnn
ydkvktellnedlankykdevvdvygsnyyvncyfsskdnvgkvtsgktcmyggitkheg
n

SCOP Domain Coordinates for d1ck1a1:

Click to download the PDB-style file with coordinates for d1ck1a1.
(The format of our PDB-style files is described here.)

Timeline for d1ck1a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ck1a2