SCOP 1.73: Domain d1c1jd_: 1c1j D:

Lineage for d1c1jd_ (1c1j D:)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
   common core: 2 helices, disulfide-linked, and a calcium-binding loop

4. Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (3 families)

5. Family a.133.1.2: Vertebrate phospholipase A2 [48623] (2 proteins)

6. Protein Snake phospholipase A2 [48624] (35 species)

7. Species Snake (Agkistrodon halys) [TaxId:8714] [48628] (9 PDB entries)

8. Domain d1c1jd_: 1c1j D: [70064]
   complexed with bog, cd

Details for d1c1jd_

PDB Entry: 1c1j, 2.8 Å

PDB Description: structure of cadmium-substituted phospholipase a2 from agkistrondon halys pallas at 2.8 angstroms resolution

PDB Compounds: (D:) basic phospholipase a2

SCOP Domain Sequences for d1c1jd_:

Sequence; same for both SEQRES and ATOM records:

>d1c1jd_ a.133.1.2 (D:) Snake phospholipase A2 {Snake (Agkistrodon halys) [TaxId: 8714]}
hllqfrkmikkmtgkepvvsyafygcycgsggrgkpknatdrccfvhdccyekvtgcdpk
wddytyswkngtivcggddpckkevcecdkaaaicfrdnlktykkrymaypdilcsskse
kc

Timeline for d1c1jd_:

• d1c1jd_ first appeared in SCOP 1.61
  
• d1c1jd_ appears in SCOP 1.71
  
• d1c1jd_ appears in SCOP 1.75
  
• d1c1jd_ appears in the current release, SCOPe 2.08