Class a: All alpha proteins [46456] (289 folds) |
Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily) common core: 2 helices, disulfide-linked, and a calcium-binding loop |
Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families) |
Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins) automatically mapped to Pfam PF00068 |
Protein Snake phospholipase A2 [48624] (38 species) |
Species Halys viper (Agkistrodon halys) [TaxId:8714] [48628] (9 PDB entries) |
Domain d1c1jc_: 1c1j C: [70063] complexed with bog, cd |
PDB Entry: 1c1j (more details), 2.8 Å
SCOPe Domain Sequences for d1c1jc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1c1jc_ a.133.1.2 (C:) Snake phospholipase A2 {Halys viper (Agkistrodon halys) [TaxId: 8714]} hllqfrkmikkmtgkepvvsyafygcycgsggrgkpknatdrccfvhdccyekvtgcdpk wddytyswkngtivcggddpckkevcecdkaaaicfrdnlktykkrymaypdilcsskse kc
Timeline for d1c1jc_: