SCOP 1.69: Domain d1c1jc_: 1c1j C:

Lineage for d1c1jc_ (1c1j C:)

1. Root: SCOP 1.69

2. Class a: All alpha proteins [46456] (218 folds)

3. Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
   common core: 2 helices, disulfide-linked, and a calcium-binding loop

4. Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (3 families)

5. Family a.133.1.2: Vertebrate phospholipase A2 [48623] (2 proteins)

6. Protein Snake phospholipase A2 [48624] (35 species)

7. Species Chinese water moccasin (Agkistrodon halys pallas), different isoforms [48628] (9 PDB entries)

8. Domain d1c1jc_: 1c1j C: [70063]

Details for d1c1jc_

PDB Entry: 1c1j, 2.8 Å

PDB Description: structure of cadmium-substituted phospholipase a2 from agkistrondon halys pallas at 2.8 angstroms resolution

SCOP Domain Sequences for d1c1jc_:

Sequence; same for both SEQRES and ATOM records:

>d1c1jc_ a.133.1.2 (C:) Snake phospholipase A2 {Chinese water moccasin (Agkistrodon halys pallas), different isoforms}
hllqfrkmikkmtgkepvvsyafygcycgsggrgkpknatdrccfvhdccyekvtgcdpk
wddytyswkngtivcggddpckkevcecdkaaaicfrdnlktykkrymaypdilcsskse
kc

Timeline for d1c1jc_:

• d1c1jc_ first appeared in SCOP 1.61
  
• d1c1jc_ appears in SCOP 1.67
  
• d1c1jc_ appears in SCOP 1.71
  
• d1c1jc_ appears in the current release, SCOPe 2.08