| Class a: All alpha proteins [46456] (218 folds) |
| Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily) common core: 2 helices, disulfide-linked, and a calcium-binding loop |
Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (3 families) ![]() |
| Family a.133.1.2: Vertebrate phospholipase A2 [48623] (2 proteins) |
| Protein Snake phospholipase A2 [48624] (35 species) |
| Species Chinese water moccasin (Agkistrodon halys pallas), different isoforms [48628] (9 PDB entries) |
| Domain d1c1jc_: 1c1j C: [70063] |
PDB Entry: 1c1j (more details), 2.8 Å
SCOP Domain Sequences for d1c1jc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1c1jc_ a.133.1.2 (C:) Snake phospholipase A2 {Chinese water moccasin (Agkistrodon halys pallas), different isoforms}
hllqfrkmikkmtgkepvvsyafygcycgsggrgkpknatdrccfvhdccyekvtgcdpk
wddytyswkngtivcggddpckkevcecdkaaaicfrdnlktykkrymaypdilcsskse
kc
Timeline for d1c1jc_: