Lineage for d1c1jc_ (1c1j C:)
- Root: SCOP 1.61
Class a: All alpha proteins [46456] (151 folds) Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily) Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (3 families) 
Family a.133.1.2: Vertebrate phospholipase A2 [48623] (2 proteins) Protein Snake phospholipase A2 [48624] (18 species) 
Species Chinese water moccasin (Agkistrodon halys pallas), different isoforms [48628] (7 PDB entries) 
Domain d1c1jc_: 1c1j C: [70063]
Details for d1c1jc_
PDB Entry: 1c1j (more details), 2.8 Å
PDB Description: structure of cadmium-substituted phospholipase a2 from agkistrondon halys pallas at 2.8 angstroms resolution
SCOP Domain Sequences for d1c1jc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1c1jc_ a.133.1.2 (C:) Snake phospholipase A2 {Chinese water moccasin (Agkistrodon halys pallas), different isoforms}
hllqfrkmikkmtgkepvvsyafygcycgsggrgkpknatdrccfvhdccyekvtgcdpk
wddytyswkngtivcggddpckkevcecdkaaaicfrdnlktykkrymaypdilcsskse
kc
SCOP Domain Coordinates for d1c1jc_:
Click to download the PDB-style file with coordinates for d1c1jc_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1c1jc_:
- d1c1jc_ is new in SCOP 1.61
- d1c1jc_ appears in SCOP 1.63
- d1c1jc_ appears in the current release, SCOPe 2.08
View in 3D
