Lineage for d1c1jb_ (1c1j B:)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 361220Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
    common core: 2 helices, disulfide-linked, and a calcium-binding loop
  4. 361221Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (3 families) (S)
  5. 361226Family a.133.1.2: Vertebrate phospholipase A2 [48623] (2 proteins)
  6. 361305Protein Snake phospholipase A2 [48624] (33 species)
  7. 361315Species Chinese water moccasin (Agkistrodon halys pallas), different isoforms [48628] (9 PDB entries)
  8. 361333Domain d1c1jb_: 1c1j B: [70062]

Details for d1c1jb_

PDB Entry: 1c1j (more details), 2.8 Å

PDB Description: structure of cadmium-substituted phospholipase a2 from agkistrondon halys pallas at 2.8 angstroms resolution

SCOP Domain Sequences for d1c1jb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c1jb_ a.133.1.2 (B:) Snake phospholipase A2 {Chinese water moccasin (Agkistrodon halys pallas), different isoforms}
hllqfrkmikkmtgkepvvsyafygcycgsggrgkpknatdrccfvhdccyekvtgcdpk
wddytyswkngtivcggddpckkevcecdkaaaicfrdnlktykkrymaypdilcsskse
kc

SCOP Domain Coordinates for d1c1jb_:

Click to download the PDB-style file with coordinates for d1c1jb_.
(The format of our PDB-style files is described here.)

Timeline for d1c1jb_: