Lineage for d1c1ja_ (1c1j A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2345955Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
    common core: 2 helices, disulfide-linked, and a calcium-binding loop
  4. 2345956Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families) (S)
  5. 2345961Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins)
    automatically mapped to Pfam PF00068
  6. 2346077Protein Snake phospholipase A2 [48624] (38 species)
  7. 2346137Species Halys viper (Agkistrodon halys) [TaxId:8714] [48628] (9 PDB entries)
  8. 2346154Domain d1c1ja_: 1c1j A: [70061]
    complexed with bog, cd

Details for d1c1ja_

PDB Entry: 1c1j (more details), 2.8 Å

PDB Description: structure of cadmium-substituted phospholipase a2 from agkistrondon halys pallas at 2.8 angstroms resolution
PDB Compounds: (A:) basic phospholipase a2

SCOPe Domain Sequences for d1c1ja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c1ja_ a.133.1.2 (A:) Snake phospholipase A2 {Halys viper (Agkistrodon halys) [TaxId: 8714]}
hllqfrkmikkmtgkepvvsyafygcycgsggrgkpknatdrccfvhdccyekvtgcdpk
wddytyswkngtivcggddpckkevcecdkaaaicfrdnlktykkrymaypdilcsskse
kc

SCOPe Domain Coordinates for d1c1ja_:

Click to download the PDB-style file with coordinates for d1c1ja_.
(The format of our PDB-style files is described here.)

Timeline for d1c1ja_: