Lineage for d1jhna4 (1jhn A:61-262,A:412-458)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2042196Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2042197Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2043878Family b.29.1.12: Calnexin/calreticulin [69236] (1 protein)
  6. 2043879Protein Calnexin [69237] (1 species)
  7. 2043880Species Dog (Canis familiaris) [TaxId:9615] [69238] (1 PDB entry)
  8. 2043881Domain d1jhna4: 1jhn A:61-262,A:412-458 [70060]
    Other proteins in same PDB: d1jhna3
    complexed with ca

Details for d1jhna4

PDB Entry: 1jhn (more details), 2.9 Å

PDB Description: Crystal Structure of the Lumenal Domain of Calnexin
PDB Compounds: (A:) calnexin

SCOPe Domain Sequences for d1jhna4:

Sequence, based on SEQRES records: (download)

>d1jhna4 b.29.1.12 (A:61-262,A:412-458) Calnexin {Dog (Canis familiaris) [TaxId: 9615]}
ykapvpsgevyfadsfdrgtlsgwilskakkddtddeiakydgkwevdemketklpgdkg
lvlmsrakhhaisaklnkpflfdtkplivqyevnfqngiecggayvkllsktpelnldqf
hdktpytimfgpdkcgedyklhfifrhknpktgvyeekhakrpdadlktyftdkkthlyt
lilnpdnsfeilvdqsivnsgnXlepfkmtpfsaiglelwsmtsdiffdnfivcgdrrvv
ddwandgwgl

Sequence, based on observed residues (ATOM records): (download)

>d1jhna4 b.29.1.12 (A:61-262,A:412-458) Calnexin {Dog (Canis familiaris) [TaxId: 9615]}
ykapvpsgevyfadsfdrgtlsgwilskakdgkwevdemketklpgdkglvlmsrakhha
isaklnkpflfdtkplivqyevnfqngiecggayvkllsktpelnldqfhdktpytimfg
pdkcgedyklhfifrhknpktgvyeekhakrpdadlktyftdkkthlytlilnpdnsfei
lvdqsivnsgnXlepfkmtpfsaiglelwsmtsdiffdnfivcgdrrvvddwandgwgl

SCOPe Domain Coordinates for d1jhna4:

Click to download the PDB-style file with coordinates for d1jhna4.
(The format of our PDB-style files is described here.)

Timeline for d1jhna4:

View in 3D
Domains from same chain:
(mouse over for more information)
d1jhna3