SCOP 1.65: Domain d8nseb_: 8nse B:

Lineage for d8nseb_ (8nse B:)

1. Root: SCOP 1.65

2. Class d: Alpha and beta proteins (a+b) [53931] (234 folds)

3. Fold d.174: Nitric oxide (NO) synthase oxygenase domain [56511] (1 superfamily)
   unusual fold

4. Superfamily d.174.1: Nitric oxide (NO) synthase oxygenase domain [56512] (1 family)

5. Family d.174.1.1: Nitric oxide (NO) synthase oxygenase domain [56513] (1 protein)

6. Protein Nitric oxide (NO) synthase oxygenase domain [56514] (6 species)

7. Species Cow (Bos taurus) [TaxId:9913] [56517] (30 PDB entries)

8. Domain d8nseb_: 8nse B: [68894]
   complexed with bh4, cad, gol, hem, nrg, zn

Details for d8nseb_

PDB Entry: 8nse, 2.25 Å

PDB Description: bovine endothelial nitric oxide synthase, nna complex

SCOP Domain Sequences for d8nseb_:

Sequence; same for both SEQRES and ATOM records:

>d8nseb_ d.174.1.1 (B:) Nitric oxide (NO) synthase oxygenase domain {Cow (Bos taurus)}
kfprvknwelgsitydtlcaqsqqdgpctprrclgslvlprklqtrpspgpppaeqllsq
ardfinqyyssikrsgsqaheerlqeveaevastgtyhlreselvfgakqawrnaprcvg
riqwgklqvfdardcssaqemftyicnhikyatnrgnlrsaitvfpqrapgrgdfriwns
qlvryagyrqqdgsvrgdpanveitelciqhgwtpgngrfdvlplllqapdeapelfvlp
pelvlevplehptlewfaalglrwyalpavsnmlleigglefsaapfsgwymsteigtrn
lcdphryniledvavcmdldtrttsslwkdkaaveinlavlhsfqlakvtivdhhaatvs
fmkhldneqkarggcpadwawivppisgsltpvfhqemvnyilspafryqpdpw

Timeline for d8nseb_:

• d8nseb_ first appeared in SCOP 1.59
  
• d8nseb_ appears in SCOP 1.63
  
• d8nseb_ appears in SCOP 1.67
  
• d8nseb_ appears in the current release, SCOPe 2.08