SCOPe 2.05: Domain d1kwha_: 1kwh A:

Lineage for d1kwha_ (1kwh A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.1: Phosphate binding protein-like [53851] (43 proteins)

6. Protein Alginate-binding periplasmic protein AlgQ2 [69624] (1 species)

7. Species Sphingomonas sp. [TaxId:28214] [69625] (2 PDB entries)

8. Domain d1kwha_: 1kwh A: [68876]
   complexed with ca

Details for d1kwha_

PDB Entry: 1kwh, 2 Å

PDB Description: structure analysis algq2, a macromolecule(alginate)-binding periplasmic protein of sphingomonas sp. a1.

PDB Compounds: (A:) Macromolecule-Binding Periplasmic Protein

SCOPe Domain Sequences for d1kwha_:

Sequence; same for both SEQRES and ATOM records:

>d1kwha_ c.94.1.1 (A:) Alginate-binding periplasmic protein AlgQ2 {Sphingomonas sp. [TaxId: 28214]}
keatwvtdkpltlkihmhfrdkwvwdenwpvakesfrltnvklqsvankaatnsqeqfnl
mmasgdlpdvvggdnlkdkfiqygqegafvplnklidqyaphikaffkshpeveraikap
dgniyfipyvpdgvvargyfiredwlkklnlkppqnidelytvlkafkekdpngngkade
vpfidrhpdevfrlvnfwgarssgsdnymdfyidngrvkhpwaetafrdgmkhvaqwyke
glidkeiftrkakareqmfggnlggfthdwfastmtfneglaktvpgfklipiapptnsk
gqrweedsrqkvrpdgwaitvknknpvetikffdfyfsrpgrdisnfgvpgvtydikngk
avfkdsvlkspqpvnnqlydmgaqipigfwqdydyerqwttpeaqagidmyvkgkyvmpg
fegvnmtreeraiydkywadvrtymyemgqawvmgtkdvdktwdeyqrqlklrglyqvlq
mmqqaydrqykn

Timeline for d1kwha_:

• d1kwha_ first appeared in SCOP 1.59
  
• d1kwha_ appears in SCOPe 2.04
  
• d1kwha_ appears in SCOPe 2.06
  
• d1kwha_ appears in the current release, SCOPe 2.08