![]() | Class b: All beta proteins [48724] (149 folds) |
![]() | Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
![]() | Superfamily b.6.1: Cupredoxins [49503] (6 families) ![]() contains copper-binding site |
![]() | Family b.6.1.3: Multidomain cupredoxins [49550] (7 proteins) |
![]() | Protein multi-copper oxidase CueO [69194] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [69195] (3 PDB entries) |
![]() | Domain d1kv7a2: 1kv7 A:171-335 [68874] |
PDB Entry: 1kv7 (more details), 1.4 Å
SCOP Domain Sequences for d1kv7a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kv7a2 b.6.1.3 (A:171-335) multi-copper oxidase CueO {Escherichia coli} mlpkqwgiddvpvivqdkkfsadgqidyqldvmtaavgwfgdtlltngaiypqhaaprgw lrlrllngcnarslnfatsdnrplyviasdggllpepvkvselpvlmgerfevlvevndn kpfdlvtlpvsqmgmaiapfdkphpvmriqpiaisasgalpdtls
Timeline for d1kv7a2: