SCOPe 2.08: Domain d1ktza_: 1ktz A:

Lineage for d1ktza_ (1ktz A:)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
   disulfide-rich fold; common core is all-beta

4. Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families)

5. Family g.17.1.2: Transforming growth factor (TGF)-beta [57507] (8 proteins)

6. Protein TGF-beta3 [57508] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [57509] (5 PDB entries)

8. Domain d1ktza_: 1ktz A: [68867]
   Other proteins in same PDB: d1ktzb_
   complexed with the type II receptor extracellular domain
   missing some secondary structures that made up less than one-third of the common domain

Details for d1ktza_

PDB Entry: 1ktz, 2.15 Å

PDB Description: Crystal Structure of the Human TGF-beta Type II Receptor Extracellular Domain in Complex with TGF-beta3

PDB Compounds: (A:) transforming growth factor beta 3

SCOPe Domain Sequences for d1ktza_:

Sequence, based on SEQRES records:

>d1ktza_ g.17.1.2 (A:) TGF-beta3 {Human (Homo sapiens) [TaxId: 9606]}
enccvrplyidfrqdlgwkwvhepkgyyanfcsgpcpylrsadtthstvlglyntlnpea
saspccvpqdlepltilyyvgrtpkveqlsnmvvksckcs

Sequence, based on observed residues (ATOM records):

>d1ktza_ g.17.1.2 (A:) TGF-beta3 {Human (Homo sapiens) [TaxId: 9606]}
enccvrplyidfrqdlgwkwvhepkgyyanfcsgpcpylrsasaspccvpqdlepltily
yvgrtpkveqlsnmvvksckcs

Timeline for d1ktza_:

• d1ktza_ first appeared in SCOP 1.59
  
• d1ktza_ appears in SCOPe 2.07