![]() | Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
![]() | Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
![]() | Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) ![]() shares functional and structural similarities with the ATP-grasp fold and PIPK |
![]() | Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins) members organized in the groups and subfamiles specified by the comments |
![]() | Protein c-src tyrosine kinase [56155] (2 species) PTK group; Src subfamily; non-membrane spanning protein tyrosine kinase |
![]() | Species Human (Homo sapiens) [TaxId:9606] [56156] (12 PDB entries) |
![]() | Domain d1kswa3: 1ksw A:249-533 [68862] Other proteins in same PDB: d1kswa1, d1kswa2 complexed with nbs; mutant |
PDB Entry: 1ksw (more details), 2.8 Å
SCOPe Domain Sequences for d1kswa3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kswa3 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} kpqtqglakdaweipreslrlevklgqgcfgevwmgtwngttrvaiktlkpgtmspeafl qeaqvmkklrheklvqlyavvseepiyivgeymskgslldflkgetgkylrlpqlvdmaa qiasgmayvermnyvhrdlraanilvgenlvckvadfglarliedneytarqgakfpikw tapeaalygrftiksdvwsfgilltelttkgrvpypgmvnrevldqvergyrmpcppecp eslhdlmcqcwrkepeerptfeylqafledyftstepqyqpgenl
Timeline for d1kswa3: