Lineage for d1kswa3 (1ksw A:249-533)
- Root: SCOP 1.61
Class d: Alpha and beta proteins (a+b) [53931] (212 folds) 
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (6 families) 
Family d.144.1.2: Tyrosine kinase [56150] (13 proteins) 
Protein c-src tyrosine kinase [56155] (2 species) Species Human (Homo sapiens) [TaxId:9606] [56156] (3 PDB entries) 
Domain d1kswa3: 1ksw A:249-533 [68862]
Other proteins in same PDB: d1kswa1, d1kswa2
Details for d1kswa3
PDB Entry: 1ksw (more details), 2.8 Å
PDB Description: structure of human c-src tyrosine kinase (thr338gly mutant) in complex with n6-benzyl adp
SCOP Domain Sequences for d1kswa3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kswa3 d.144.1.2 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens)}
kpqtqglakdaweipreslrlevklgqgcfgevwmgtwngttrvaiktlkpgtmspeafl
qeaqvmkklrheklvqlyavvseepiyivgeymskgslldflkgetgkylrlpqlvdmaa
qiasgmayvermnyvhrdlraanilvgenlvckvadfglarliedneytarqgakfpikw
tapeaalygrftiksdvwsfgilltelttkgrvpypgmvnrevldqvergyrmpcppecp
eslhdlmcqcwrkepeerptfeylqafledyftstepqyqpgenl
SCOP Domain Coordinates for d1kswa3:
Click to download the PDB-style file with coordinates for d1kswa3.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1kswa3:
- d1kswa3 first appeared in SCOP 1.59
- d1kswa3 appears in SCOP 1.63
- d1kswa3 appears in the current release, SCOPe 2.08
View in 3D
