Lineage for d1kswa3 (1ksw A:249-533)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 138043Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
  4. 138044Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (6 families) (S)
  5. 138202Family d.144.1.2: Tyrosine kinase [56150] (11 proteins)
  6. 138209Protein c-src tyrosine kinase [56155] (2 species)
  7. 138212Species Human (Homo sapiens) [TaxId:9606] [56156] (3 PDB entries)
  8. 138215Domain d1kswa3: 1ksw A:249-533 [68862]
    Other proteins in same PDB: d1kswa1, d1kswa2

Details for d1kswa3

PDB Entry: 1ksw (more details), 2.8 Å

PDB Description: structure of human c-src tyrosine kinase (thr338gly mutant) in complex with n6-benzyl adp

SCOP Domain Sequences for d1kswa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kswa3 d.144.1.2 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens)}
kpqtqglakdaweipreslrlevklgqgcfgevwmgtwngttrvaiktlkpgtmspeafl
qeaqvmkklrheklvqlyavvseepiyivgeymskgslldflkgetgkylrlpqlvdmaa
qiasgmayvermnyvhrdlraanilvgenlvckvadfglarliedneytarqgakfpikw
tapeaalygrftiksdvwsfgilltelttkgrvpypgmvnrevldqvergyrmpcppecp
eslhdlmcqcwrkepeerptfeylqafledyftstepqyqpgenl

SCOP Domain Coordinates for d1kswa3:

Click to download the PDB-style file with coordinates for d1kswa3.
(The format of our PDB-style files is described here.)

Timeline for d1kswa3: