![]() | Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
![]() | Fold d.93: SH2-like [55549] (1 superfamily) 3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices |
![]() | Superfamily d.93.1: SH2 domain [55550] (2 families) ![]() |
![]() | Family d.93.1.1: SH2 domain [55551] (35 proteins) Pfam PF00017 |
![]() | Protein c-src tyrosine kinase [55556] (3 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [55557] (46 PDB entries) |
![]() | Domain d1kswa2: 1ksw A:146-248 [68861] Other proteins in same PDB: d1kswa1, d1kswa3 complexed with nbs; mutant |
PDB Entry: 1ksw (more details), 2.8 Å
SCOPe Domain Sequences for d1kswa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kswa2 d.93.1.1 (A:146-248) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} eewyfgkitrreserlllnaenprgtflvresettkgayclsvsdfdnakglnvkhykir kldsggfyitsrtqfnslqqlvayyskhadglchrlttvcpts
Timeline for d1kswa2: