SCOP 1.61: Domain d1kswa2: 1ksw A:146-248

Lineage for d1kswa2 (1ksw A:146-248)

1. Root: SCOP 1.61

2. Class d: Alpha and beta proteins (a+b) [53931] (212 folds)

3. Fold d.93: SH2-like [55549] (1 superfamily)

4. Superfamily d.93.1: SH2 domain [55550] (1 family)

5. Family d.93.1.1: SH2 domain [55551] (20 proteins)

6. Protein c-src tyrosine kinase [55556] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [55557] (13 PDB entries)

8. Domain d1kswa2: 1ksw A:146-248 [68861]
   Other proteins in same PDB: d1kswa1, d1kswa3

Details for d1kswa2

PDB Entry: 1ksw, 2.8 Å

PDB Description: structure of human c-src tyrosine kinase (thr338gly mutant) in complex with n6-benzyl adp

SCOP Domain Sequences for d1kswa2:

Sequence; same for both SEQRES and ATOM records:

>d1kswa2 d.93.1.1 (A:146-248) c-src tyrosine kinase {Human (Homo sapiens)}
eewyfgkitrreserlllnaenprgtflvresettkgayclsvsdfdnakglnvkhykir
kldsggfyitsrtqfnslqqlvayyskhadglchrlttvcpts

Timeline for d1kswa2:

• d1kswa2 first appeared in SCOP 1.59
  
• d1kswa2 appears in SCOP 1.63
  
• d1kswa2 appears in the current release, SCOPe 2.08