Lineage for d1kswa1 (1ksw A:84-145)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 165384Fold b.34: SH3-like barrel [50036] (10 superfamilies)
  4. 165426Superfamily b.34.2: SH3-domain [50044] (1 family) (S)
  5. 165427Family b.34.2.1: SH3-domain [50045] (23 proteins)
  6. 165474Protein c-src protein tyrosine kinase [50064] (3 species)
  7. 165488Species Human (Homo sapiens) [TaxId:9606] [50065] (3 PDB entries)
  8. 165491Domain d1kswa1: 1ksw A:84-145 [68860]
    Other proteins in same PDB: d1kswa2, d1kswa3

Details for d1kswa1

PDB Entry: 1ksw (more details), 2.8 Å

PDB Description: structure of human c-src tyrosine kinase (thr338gly mutant) in complex with n6-benzyl adp

SCOP Domain Sequences for d1kswa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kswa1 b.34.2.1 (A:84-145) c-src protein tyrosine kinase {Human (Homo sapiens)}
ttfvalydyesrtetdlsfkkgerlqivnntegdwwlahslstgqtgyipsnyvapsdsi
qa

SCOP Domain Coordinates for d1kswa1:

Click to download the PDB-style file with coordinates for d1kswa1.
(The format of our PDB-style files is described here.)

Timeline for d1kswa1: