![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
![]() | Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
![]() | Family c.2.1.6: 6-phosphogluconate dehydrogenase-like, N-terminal domain [51868] (18 proteins) the beta-sheet is extended to 8 strands, order 32145678; strands 7 & 8 are antiparallel to the rest C-terminal domains also show some similarity |
![]() | Protein Ketopantoate reductase PanE [69419] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [69420] (4 PDB entries) |
![]() | Domain d1ks9a2: 1ks9 A:1-167 [68858] Other proteins in same PDB: d1ks9a1 |
PDB Entry: 1ks9 (more details), 1.7 Å
SCOPe Domain Sequences for d1ks9a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} mkitvlgcgalgqlwltalckqghevqgwlrvpqpycsvnlvetdgsifnesltandpdf latsdlllvtlkawqvsdavkslastlpvttpillihngmgtieelqniqqpllmgttth aarrdgnviihvangithigparqqdgdysyladilqtvlpdvawhn
Timeline for d1ks9a2: