Class a: All alpha proteins [46456] (290 folds) |
Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily) multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry |
Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) N-terminal domain is Rossmann-fold with a family-specific C-terminal extension |
Family a.100.1.7: Ketopantoate reductase PanE [69084] (1 protein) automatically mapped to Pfam PF08546 |
Protein Ketopantoate reductase PanE [69085] (1 species) |
Species Escherichia coli [TaxId:562] [69086] (4 PDB entries) |
Domain d1ks9a1: 1ks9 A:168-291 [68857] Other proteins in same PDB: d1ks9a2 |
PDB Entry: 1ks9 (more details), 1.7 Å
SCOPe Domain Sequences for d1ks9a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ks9a1 a.100.1.7 (A:168-291) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} niraelwrklavncvinpltaiwncpngelrhhpqeimqiceevaaviereghhtsaedl rdyvmqvidataenissmlqdiralrhteidyingfllrrarahgiavpentrlfemvkr kese
Timeline for d1ks9a1: