Lineage for d1ks0a_ (1ks0 A:)

  1. Root: SCOP 1.61
  2. 202290Class g: Small proteins [56992] (59 folds)
  3. 203830Fold g.14: Kringle-like [57439] (1 superfamily)
  4. 203831Superfamily g.14.1: Kringle-like [57440] (2 families) (S)
  5. 203907Family g.14.1.2: Fibronectin type II module [57459] (4 proteins)
  6. 203916Protein Gelatinase A (MMP-2) type II modules [57464] (1 species)
  7. 203917Species Human (Homo sapiens) [TaxId:9606] [57465] (6 PDB entries)
  8. 203941Domain d1ks0a_: 1ks0 A: [68856]

Details for d1ks0a_

PDB Entry: 1ks0 (more details)

PDB Description: the first fibronectin type ii module from human matrix metalloproteinase 2

SCOP Domain Sequences for d1ks0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ks0a_ g.14.1.2 (A:) Gelatinase A (MMP-2) type II modules {Human (Homo sapiens)}
ripvkygnadgeyckfpflfngkeynsctdtgrsdgflwcsttynfekdgkygfcphea

SCOP Domain Coordinates for d1ks0a_:

Click to download the PDB-style file with coordinates for d1ks0a_.
(The format of our PDB-style files is described here.)

Timeline for d1ks0a_: