SCOPe 2.08: Domain d1ks0a1: 1ks0 A:4-59

Lineage for d1ks0a1 (1ks0 A:4-59)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.14: Kringle-like [57439] (1 superfamily)
   disulfide-rich fold; nearly all-beta

4. Superfamily g.14.1: Kringle-like [57440] (3 families)

5. Family g.14.1.2: Fibronectin type II module [57459] (4 proteins)
   shorter two-disulfide version of a kringle module

6. Protein Gelatinase A (MMP-2) type II modules [57464] (1 species)
   duplication: tandem repeat of three modules inserted in the catalytic domain

7. Species Human (Homo sapiens) [TaxId:9606] [57465] (6 PDB entries)

8. Domain d1ks0a1: 1ks0 A:4-59 [68856]
   Other proteins in same PDB: d1ks0a2
   first module only

Details for d1ks0a1

PDB Entry: 1ks0

PDB Description: the first fibronectin type ii module from human matrix metalloproteinase 2

PDB Compounds: (A:) matrix metalloproteinase 2

SCOPe Domain Sequences for d1ks0a1:

Sequence; same for both SEQRES and ATOM records:

>d1ks0a1 g.14.1.2 (A:4-59) Gelatinase A (MMP-2) type II modules {Human (Homo sapiens) [TaxId: 9606]}
vkygnadgeyckfpflfngkeynsctdtgrsdgflwcsttynfekdgkygfcphea

Timeline for d1ks0a1:

• d1ks0a1 first appeared in SCOP 1.59, called d1ks0a_
  
• d1ks0a1 appears in SCOPe 2.07