SCOP 1.59: Domain d1krl.1: 1krl B:,A:

Lineage for d1krl.1 (1krl B:,A:)

1. Root: SCOP 1.59

2. Class d: Alpha and beta proteins (a+b) [53931] (208 folds)

3. Fold d.17: Cystatin-like [54402] (5 superfamilies)

4. Superfamily d.17.1: Cystatin/monellin [54403] (2 families)

5. Family d.17.1.1: Monellin [54404] (1 protein)

6. Protein Monellin, B & A chains together [54405] (1 species)

7. Species Serendipity berry (Dioscoreophyllum cumminsii) [TaxId:3457] [54406] (7 PDB entries)

8. Domain d1krl.1: 1krl B:,A: [68853]

Details for d1krl.1

PDB Entry: 1krl, 1.9 Å

PDB Description: crystal structure of racemic dl-monellin in p-1

SCOP Domain Sequences for d1krl.1:

Sequence; same for both SEQRES and ATOM records:

>g1krl.1 d.17.1.1 (B:,A:) Monellin, B & A chains together {Serendipity berry (Dioscoreophyllum cumminsii)}
geweiidigpftqnlgkfavdeenkigqygrltfnkvirpcmkktiyeXreikgyeyqly
vyasdklfradisedyktrgrkllrfngpvppp

Timeline for d1krl.1:

• d1krl.1 is new in SCOP 1.59
  
• d1krl.1 appears in SCOP 1.61
  
• d1krl.1 appears in the current release, SCOPe 2.08