Lineage for d1krfb_ (1krf B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004058Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 2004325Superfamily a.102.2: Seven-hairpin glycosidases [48225] (1 family) (S)
    automatically mapped to Pfam PF01532
  5. 2004326Family a.102.2.1: Class I alpha-1;2-mannosidase, catalytic domain [48226] (1 protein)
  6. 2004327Protein Class I alpha-1;2-mannosidase, catalytic domain [48227] (5 species)
  7. 2004331Species Fungus (Penicillium citrinum) [TaxId:5077] [69088] (5 PDB entries)
  8. 2004337Domain d1krfb_: 1krf B: [68851]
    complexed with ca, kif

Details for d1krfb_

PDB Entry: 1krf (more details), 2.2 Å

PDB Description: structure of p. citrinum alpha 1,2-mannosidase reveals the basis for differences in specificity of the er and golgi class i enzymes
PDB Compounds: (B:) Mannosyl-oligosaccharide alpha-1,2-mannosidase

SCOPe Domain Sequences for d1krfb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1krfb_ a.102.2.1 (B:) Class I alpha-1;2-mannosidase, catalytic domain {Fungus (Penicillium citrinum) [TaxId: 5077]}
snqakadavkeafqhawngymkyafphdeltpvsnghadsrngwgasavdalstavimgk
advvnailehvadidfsktsdtvslfettirylagmlsgydllqgpaknlvdnqdlidgl
ldqsrnladvlkfafdtpsgvpynninitshgndgattnglavtgtlvlewtrlsdltgd
eeyaklsqkaesyllkpqpsssepfpglvgssinindgqfadsrvswnggddsfyeylik
myvydpkrfetykdrwvlaaestikhlkshpksrpdltflssysnrnydlssqhltcfdg
gsfllggtvldrqdfidfglelvdgceatynstltkigpdswgwdpkkvpsdqkefyeka
gfyissgsyvlrpeviesfyyahrvtgkeiyrdwvwnafvainstcrtdsgfaavsdvnk
anggskydnqesflfaevmkysylahsedaawqvqkggkntfvynteahpisvar

SCOPe Domain Coordinates for d1krfb_:

Click to download the PDB-style file with coordinates for d1krfb_.
(The format of our PDB-style files is described here.)

Timeline for d1krfb_: