Lineage for d1kr5a_ (1kr5 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2892669Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2892670Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) (S)
  5. 2893083Family c.66.1.7: Protein-L-isoaspartyl O-methyltransferase [53354] (1 protein)
    topological variant; strand order 3214567; strand 6 is antiparallel to the rest
    automatically mapped to Pfam PF01135
  6. 2893084Protein Protein-L-isoaspartyl O-methyltransferase [68927] (5 species)
  7. 2893087Species Human (Homo sapiens) [TaxId:9606] [69554] (2 PDB entries)
  8. 2893089Domain d1kr5a_: 1kr5 A: [68847]
    complexed with sah

Details for d1kr5a_

PDB Entry: 1kr5 (more details), 2.1 Å

PDB Description: crystal structure of human l-isoaspartyl methyltransferase
PDB Compounds: (A:) protein-l-isoaspartate o-methyltransferase

SCOPe Domain Sequences for d1kr5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kr5a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Human (Homo sapiens) [TaxId: 9606]}
ashselihnlrkngiiktdkvfevmlatdrshyakcnpymdspqsigfqatisaphmhay
alellfdqlhegakaldvgsgsgiltacfarmvgctgkvigidhikelvddsvnnvrkdd
ptllssgrvqlvvgdgrmgyaeeapydaihvgaaapvvpqalidqlkpggrlilpvgpag
gnqmleqydklqdgsikmkplmgviyvpltdkekqwsr

SCOPe Domain Coordinates for d1kr5a_:

Click to download the PDB-style file with coordinates for d1kr5a_.
(The format of our PDB-style files is described here.)

Timeline for d1kr5a_: