Lineage for d1kr1a_ (1kr1 A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2438500Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2440387Family c.1.8.5: Type II chitinase [51534] (15 proteins)
    glycosylase family 18
  6. 2440550Protein Hevamine A (chitinase/lysozyme) [51535] (1 species)
  7. 2440551Species Rubber tree (Hevea brasiliensis) [TaxId:3981] [51536] (7 PDB entries)
  8. 2440557Domain d1kr1a_: 1kr1 A: [68846]
    complexed with so4; mutant

Details for d1kr1a_

PDB Entry: 1kr1 (more details), 2 Å

PDB Description: hevamine mutant d125a/e127a in complex with tetra-nag
PDB Compounds: (A:) hevamine a

SCOPe Domain Sequences for d1kr1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kr1a_ c.1.8.5 (A:) Hevamine A (chitinase/lysozyme) {Rubber tree (Hevea brasiliensis) [TaxId: 3981]}
ggiaiywgqngnegtltqtcstrkysyvniaflnkfgngqtpqinlaghcnpaaggctiv
sngirscqiqgikvmlslgggigsytlasqadaknvadylwnnflggksssrplgdavld
gidfaiahgstlywddlarylsayskqgkkvyltaapqcpfpdrylgtalntglfdyvwv
qfynnppcqyssgninniinswnrwttsinagkiflglpaapeaagsgyvppdvlisril
peikkspkyggvmlwskfyddkngysssildsv

SCOPe Domain Coordinates for d1kr1a_:

Click to download the PDB-style file with coordinates for d1kr1a_.
(The format of our PDB-style files is described here.)

Timeline for d1kr1a_: