Lineage for d1kqza_ (1kqz A:)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 172678Fold c.1: TIM beta/alpha-barrel [51350] (25 superfamilies)
  4. 173209Superfamily c.1.8: (Trans)glycosidases [51445] (9 families) (S)
  5. 173778Family c.1.8.5: Type II chitinase [51534] (9 proteins)
  6. 173829Protein Hevamine A (chitinase/lysozyme) [51535] (1 species)
  7. 173830Species Para rubber tree (Hevea brasiliensis) [TaxId:3981] [51536] (7 PDB entries)
  8. 173833Domain d1kqza_: 1kqz A: [68844]

Details for d1kqza_

PDB Entry: 1kqz (more details), 1.92 Å

PDB Description: hevamine mutant d125a/e127a/y183f in complex with tetra-nag

SCOP Domain Sequences for d1kqza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kqza_ c.1.8.5 (A:) Hevamine A (chitinase/lysozyme) {Para rubber tree (Hevea brasiliensis)}
ggiaiywgqngnegtltqtcstrkysyvniaflnkfgngqtpqinlaghcnpaaggctiv
sngirscqiqgikvmlslgggigsytlasqadaknvadylwnnflggksssrplgdavld
gidfaiahgstlywddlarylsayskqgkkvyltaapqcpfpdrylgtalntglfdyvwv
qffnnppcqyssgninniinswnrwttsinagkiflglpaapeaagsgyvppdvlisril
peikkspkyggvmlwskfyddkngysssildsv

SCOP Domain Coordinates for d1kqza_:

Click to download the PDB-style file with coordinates for d1kqza_.
(The format of our PDB-style files is described here.)

Timeline for d1kqza_: