Lineage for d1kqsz_ (1kqs Z:)

  1. Root: SCOP 1.67
  2. 427008Class g: Small proteins [56992] (72 folds)
  3. 430156Fold g.41: Rubredoxin-like [57769] (13 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 430415Superfamily g.41.8: Zn-binding ribosomal proteins [57829] (4 families) (S)
  5. 430437Family g.41.8.2: Ribosomal protein L37e [57833] (1 protein)
  6. 430438Protein Ribosomal protein L37e [57834] (1 species)
  7. 430439Species Archaeon Haloarcula marismortui [TaxId:2238] [57835] (18 PDB entries)
  8. 430451Domain d1kqsz_: 1kqs Z: [68841]
    Other proteins in same PDB: d1kqs1_, d1kqs2_, d1kqsa1, d1kqsa2, d1kqsb_, d1kqsc_, d1kqsd_, d1kqse1, d1kqse2, d1kqsf_, d1kqsg_, d1kqsh_, d1kqsi_, d1kqsj_, d1kqsk_, d1kqsl_, d1kqsm_, d1kqsn_, d1kqso_, d1kqsp_, d1kqsq_, d1kqsr_, d1kqss_, d1kqst_, d1kqsu_, d1kqsv_, d1kqsw_, d1kqsx_, d1kqsy_
    complexed with aca, btn, cd, cl, k, mg, na, pha, ppu

Details for d1kqsz_

PDB Entry: 1kqs (more details), 3.1 Å

PDB Description: The Haloarcula marismortui 50S Complexed with a Pretranslocational Intermediate in Protein Synthesis

SCOP Domain Sequences for d1kqsz_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kqsz_ g.41.8.2 (Z:) Ribosomal protein L37e {Archaeon Haloarcula marismortui}
tgagtpsqgkknttthtkcrrcgeksyhtkkkvcsscgfgksakrrdyewqskage

SCOP Domain Coordinates for d1kqsz_:

Click to download the PDB-style file with coordinates for d1kqsz_.
(The format of our PDB-style files is described here.)

Timeline for d1kqsz_: