Lineage for d1kqsy_ (1kqs Y:)

  1. Root: SCOP 1.59
  2. 142453Class g: Small proteins [56992] (58 folds)
  3. 144883Fold g.41: Rubredoxin-like [57769] (9 superfamilies)
  4. 145087Superfamily g.41.8: Zn-binding ribosomal proteins [57829] (3 families) (S)
  5. 145088Family g.41.8.1: Ribosomal protein L37ae [57830] (1 protein)
  6. 145089Protein Ribosomal protein L37ae [57831] (1 species)
  7. 145090Species Archaeon Haloarcula marismortui [TaxId:2238] [57832] (3 PDB entries)
  8. 145092Domain d1kqsy_: 1kqs Y: [68840]
    Other proteins in same PDB: d1kqs1_, d1kqs2_, d1kqsa1, d1kqsa2, d1kqsb_, d1kqsc_, d1kqsd_, d1kqse1, d1kqse2, d1kqsf_, d1kqsg_, d1kqsh_, d1kqsi_, d1kqsj_, d1kqsk_, d1kqsl_, d1kqsm_, d1kqsn_, d1kqso_, d1kqsp_, d1kqsq_, d1kqsr_, d1kqss_, d1kqst_, d1kqsu_, d1kqsv_, d1kqsw_, d1kqsx_, d1kqsz_

Details for d1kqsy_

PDB Entry: 1kqs (more details), 3.1 Å

PDB Description: The Haloarcula marismortui 50S Complexed with a Pretranslocational Intermediate in Protein Synthesis

SCOP Domain Sequences for d1kqsy_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kqsy_ g.41.8.1 (Y:) Ribosomal protein L37ae {Archaeon Haloarcula marismortui}
rtgrfgpryglkirvrvadveikhkkkhkcpvcgfkklkragtgiwmcghcgykiaggcy
qpetvagkavmka

SCOP Domain Coordinates for d1kqsy_:

Click to download the PDB-style file with coordinates for d1kqsy_.
(The format of our PDB-style files is described here.)

Timeline for d1kqsy_: