Lineage for d1kqsx_ (1kqs X:)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 577539Fold c.9: Barstar-like [52037] (2 superfamilies)
    2 layers, a/b; parallel beta-sheet of 3 strands, order 123
  4. 577568Superfamily c.9.2: Ribosomal protein L32e [52042] (1 family) (S)
  5. 577569Family c.9.2.1: Ribosomal protein L32e [52043] (1 protein)
    contains irregular N-terminal extension to the common fold
  6. 577570Protein Ribosomal protein L32e [52044] (1 species)
  7. 577571Species Archaeon Haloarcula marismortui [TaxId:2238] [52045] (19 PDB entries)
  8. 577584Domain d1kqsx_: 1kqs X: [68839]
    Other proteins in same PDB: d1kqs1_, d1kqs2_, d1kqsa1, d1kqsa2, d1kqsb_, d1kqsc_, d1kqsd_, d1kqse1, d1kqse2, d1kqsf_, d1kqsg_, d1kqsh_, d1kqsi_, d1kqsj_, d1kqsk_, d1kqsl_, d1kqsm_, d1kqsn_, d1kqso_, d1kqsp_, d1kqsq_, d1kqsr_, d1kqss_, d1kqst_, d1kqsu_, d1kqsv_, d1kqsw_, d1kqsy_, d1kqsz_
    complexed with aca, btn, cd, cl, k, mg, na, pha, ppu

Details for d1kqsx_

PDB Entry: 1kqs (more details), 3.1 Å

PDB Description: The Haloarcula marismortui 50S Complexed with a Pretranslocational Intermediate in Protein Synthesis

SCOP Domain Sequences for d1kqsx_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kqsx_ c.9.2.1 (X:) Ribosomal protein L32e {Archaeon Haloarcula marismortui}
telqargltektpdlsdedarlltqrhrvgkpqfnrqdhhkkkrvstswrkprgqlskqr
rgikgkgdtveagfrsptavrgkhpsgfeevrvhnvddlegvdgdteavriaskvgarkr
erieeeaedagirvlnptyvev

SCOP Domain Coordinates for d1kqsx_:

Click to download the PDB-style file with coordinates for d1kqsx_.
(The format of our PDB-style files is described here.)

Timeline for d1kqsx_: